PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G032357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family Trihelix
Protein Properties Length: 837aa    MW: 95227.5 Da    PI: 6.9027
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G032357.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix51.42.9e-16172248285
              trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                           W+++evlaL+ +r+ me+++ +       We+vs+k++e gf+rs+++Ckek+e+ ++++ + ++++ ++    s+ c  +++l
  HL.SW.v1.0.G032357.1 172 WSEDEVLALLGIRSTMENWFPDF-----TWEHVSRKLAELGFKRSAEKCKEKFEEESQYFNNNNNNNCSK--SYSRICTQLSEL 248
                           ********************998.....9********************************999999885..444456666655 PP

2trihelix89.24.4e-28606715186
              trihelix   1 rWtkqevlaLiearr..............emeerlrrgk...................lkkplWeevskkmrergferspkqCkekwen 56 
                           rW+++evlaLi++r                        +                    k+plWe++s+ m e g++rs+k+Ckekwen
  HL.SW.v1.0.G032357.1 606 RWPRDEVLALINLRCnlystatttttataG--------EssdhhkegmlvssstspssVKAPLWERISQGMLELGYKRSAKRCKEKWEN 686
                           8**************555555554444440........04555555566666666666******************************* PP

              trihelix  57 lnkrykkikegekkrtsessstcpyfdqle 86 
                           +nk+++k+k+ +kkr s +s+tcpyf+ql 
  HL.SW.v1.0.G032357.1 687 INKYFRKTKDANKKR-SVDSRTCPYFHQLS 715
                           **************8.78889*******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.121164223IPR017877Myb-like domain
SMARTSM0071732168225IPR001005SANT/Myb domain
PfamPF138372.0E-10171235No hitNo description
SMARTSM007170.15603690IPR001005SANT/Myb domain
PfamPF138371.4E-16605716No hitNo description
CDDcd122031.61E-22605695No hitNo description
PROSITE profilePS500905.599606688IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0001158Molecular Functionenhancer sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MFNGGVPDQL HQFIASSRPN SVVSLLPLST TNSITTTPFS SNSSIDNIHA NYTPNHAHES  60
HHHHHHHLLH HQLLPPLHHP NFLHPMLHHV QQQQQQQQHH PKLNHHLHHH QKDIDEQAAA  120
ATGPNSLVSE VDLEMMETHT PIPELIPTVD HHHHHNHHHS HHPHPHPHLQ PWSEDEVLAL  180
LGIRSTMENW FPDFTWEHVS RKLAELGFKR SAEKCKEKFE EESQYFNNNN NNNCSKSYSR  240
ICTQLSELEE LYHGESQVHH HQHQNHHNGT AVNEKDQRVE ENPSELDVKI RDINNGHHRQ  300
SLEELEISDS TRNETVVLLG GNSKEYYSDE TEKVVVVGVE IAKSGNIENN KQNNDSNNNN  360
KSSKKRKRSS SSSSSSHENY NKMKFDMFKG FCEEIVKKMM AQQEEMHNKL LEDMVKRDQE  420
KVAIEEAWKK QEIDRMNKEL EIMAHEQAVA GDRQASIIDF LNKVTCSNSA HESTQFSKLS  480
NKDNNNNKEV SLTNSSSSSS LVLLHQPHEQ NIPPPANPTI THLEKNQTNH HHHTQYYDQQ  540
QQQPSSSSSP SRHHHRQKTS SGISKDIIVA VSSTTHLANK PTATSPPNKT IQNPTSINDK  600
EDLGKRWPRD EVLALINLRC NLYSTATTTT TATAGESSDH HKEGMLVSSS TSPSSVKAPL  660
WERISQGMLE LGYKRSAKRC KEKWENINKY FRKTKDANKK RSVDSRTCPY FHQLSSLYNK  720
GATTTLVSVS SSQGQNNNDH HQDHIVINND HHHSPSSVVV LPEISTAIAT ASRQLIIDES  780
TTPADDDHNH DSTQLHIDQG ERSSSVNNII IHDHHHHHHH HQEVAVVAST AFDFEF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363368KKRKRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00011PBMTransfer from AT5G28300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.13e-41Trihelix family protein